Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR418W  from Saccharomyces cerevisiae S288C
>YDR418W|YDR418W RPL12B SGDID:S000002826, Chr IV from 1301616-1302113, Genome Release 64-1-1, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl12Ap; rpl12a rpl12b double mutant exhibits slow growth and slow translation; has similarity to E. coli L11 and rat L12 ribosomal proteins" ORGANISM: Saccharomyces cerevisiae S288C (165 aa)
MPPKFDPNEVKYLYLRAVGGEVGASAALAPKIGPLGLSPKKVGEDIAKATKEFKGIKVTV
QLKIQNRQAAASVVPSASSLVITALKEPPRDRKKDKNVKHSGNIQLDEIIEIARQMRDKS
FGRTLASVTKEILGTAQSVGCRVDFKNPHDIIEGINAGEIEIPEN