Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR404C  from Saccharomyces cerevisiae S288C
>YDR404C|YDR404C RPB7 SGDID:S000002812, Chr IV from 1277169-1276654, Genome Release 64-1-1, reverse complement, Verified ORF, "RNA polymerase II subunit B16; forms two subunit dissociable complex with Rpb4p; involved in recruitment of 3'-end processing factors to transcribing RNA polymerase II complex and in export of mRNA to cytoplasm under stress conditions; also involved in translation initiation" ORGANISM: Saccharomyces cerevisiae S288C (171 aa)
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGR
ILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLT
FNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI