Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR397C  from Saccharomyces cerevisiae S288C
>YDR397C|YDR397C NCB2 SGDID:S000002805, Chr IV from 1266769-1266366,1266898-1266862, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of a heterodimeric NC2 transcription regulator complex with Bur6p; complex binds to TBP and can repress transcription by preventing preinitiation complex assembly or stimulate activated transcription; homologous to human NC2beta" ORGANISM: Saccharomyces cerevisiae S288C (146 aa)
MAGDSDNVSLPKATVQKMISEILDQDLMFTKDAREIIINSGIEFIMILSSMASEMADNEA
KKTIAPEHVIKALEELEYNEFIPFLEEILLNFKGSQKVKETRDSKFKKSGLSEEELLRQQ
EELFRQSRSRLHHNSVSDPVKSEDSS