Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR391C  from Saccharomyces cerevisiae S288C
>YDR391C|YDR391C YDR391C SGDID:S000002799, Chr IV from 1258056-1257358, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function, possibly involved in zinc homeostasis; Bdf1p-dependent transcription induced by salt stress; green fluorescent protein (GFP)-fusion protein localizes to both the cytoplasm and the nucleus" ORGANISM: Saccharomyces cerevisiae S288C (232 aa)
MSFENKLPTPLENNDAKGHMVCTLNKTTDARRAAETLSIAFSNSPAFHFICKKILNIPLA
EKVPTRTITTDIISPFLDSPYGEISEVNTFDAVAVWSLPPHVPKARSNDAKFNKDFIDDL
NARVKQVIPNGINYYYLFCIGKNLNEKGIRGSVRTIFEEYKRRADEENCAIVLEAIAEHA
KSVYEYFGFRNYMTFKYGECEVDSNGNCDPNGEGFTAYLMIYHKDGNKVLKE