Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR381W  from Saccharomyces cerevisiae S288C
>YDR381W|YDR381W YRA1 SGDID:S000002789, Chr IV from 1236558-1236842,1237609-1238004, Genome Release 64-1-1, Verified ORF, "RNA binding protein required for export of poly(A)+ mRNA from the nucleus; proposed to couple mRNA export with 3' end processing via its interactions with Mex67p and Pcf11p; functionally redundant with Yra2p, another REF family member" ORGANISM: Saccharomyces cerevisiae S288C (226 aa)
MSANLDKSLDEIIGSNKAGSNRARVGGTRGNGPRRVGKQVGSQRRSLPNRRGPIRKNTRA
PPNAVARVAKLLDTTREVKVNVEGLPRDIKQDAVREFFASQVGGVQRVLLSYNERGQSTG
MANITFKNGELARRAVERFNGSPIDGGRSRLRLNLIVDPNQRPVKSLADRIKAMPQKGGN
APRPVKRGPNRKAAMAKSQNKPKREKPAKKSLEDLDKEMADYFEKK