Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YDR381C-A  from Saccharomyces cerevisiae S288C
>YDR381C-A|YDR381C-A YDR381C-A SGDID:S000007650, Chr IV from 1238630-1238312,1238850-1238825, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function, localized to the mitochondrial outer membrane" ORGANISM: Saccharomyces cerevisiae S288C (114 aa)
MSNPFQNIGKNLLYISAAGIASIYVVKTIVKARRDAKFIPKARGNNGEVNEKNYYDNLAQ
VKPGFPIPKDGGDNIDCSEDHQLVRKSKYEGSGLSAVTRKRGDKLGFLDRRRNE