Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR379C-A  from Saccharomyces cerevisiae S288C
>YDR379C-A|YDR379C-A YDR379C-A SGDID:S000007605, Chr IV from 1233517-1233278, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein involved in the assembly of the mitochondrial succinate dehydrogenase complex; mutations in human ortholog SDHAF1 are associated with infantile leukoencephalopathy" ORGANISM: Saccharomyces cerevisiae S288C (79 aa)
MPKRLSGLQKEVLHLYRASIRTAHTKPKENQVNFVNYIHEEFGKYRNLPRKDFTTIEHLL
RVGNKKIATFSHPELTNIH