Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR378C  from Saccharomyces cerevisiae S288C
>YDR378C|YDR378C LSM6 SGDID:S000002786, Chr IV from 1229609-1229349, Genome Release 64-1-1, reverse complement, Verified ORF, "Lsm (Like Sm) protein; part of heteroheptameric complexes (Lsm2p-7p and either Lsm1p or 8p): cytoplasmic Lsm1p complex involved in mRNA decay; nuclear Lsm8p complex part of U6 snRNP and possibly involved in processing tRNA, snoRNA, and rRNA" ORGANISM: Saccharomyces cerevisiae S288C (86 aa)
MSGKASTEGSVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNN
NKLLNKFNSDVFLRGTQVMYISEQKI