Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR377W  from Saccharomyces cerevisiae S288C
>YDR377W|YDR377W ATP17 SGDID:S000002785, Chr IV from 1228611-1228916, Genome Release 64-1-1, Verified ORF, "Subunit f of the F0 sector of mitochondrial F1F0 ATP synthase, which is a large, evolutionarily conserved enzyme complex required for ATP synthesis" ORGANISM: Saccharomyces cerevisiae S288C (101 aa)
MIFKRAVSTLIPPKVVSSKNIGSAPNAKRIANVVHFYKSLPQGPAPAIKANTRLARYKAK
YFDGDNASGKPLWHFALGIIAFGYSMEYYFHLRHHKGAEEH