Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YDR374W-A  from Saccharomyces cerevisiae S288C
>YDR374W-A|YDR374W-A YDR374W-A SGDID:S000113553, Chr IV from 1224757-1225026, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function" ORGANISM: Saccharomyces cerevisiae S288C (89 aa)
MDTEALANYLLRQLSLDAEENKLEDLLQRQNEDQESSQEYNKKLLLACGFQAILRKILLD
ARTRATAEGLREVYPYHIEAATQAFLDSQ