Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR367W  from Saccharomyces cerevisiae S288C
>YDR367W|YDR367W KEI1 SGDID:S000002775, Chr IV from 1212848-1212877,1212979-1213614, Genome Release 64-1-1, Verified ORF, "Component of inositol phosphorylceramide (IPC) synthase; forms a complex with Aur1p and regulates its activity; required for IPC synthase complex localization to the Golgi; post-translationally processed by Kex2p; KEI1 is an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (221 aa)
MRSSLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWS
VFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCFFTLWFTTQWFTLEDTANIDGNN
ALQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLH
HPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLLE