Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR363W-A  from Saccharomyces cerevisiae S288C
>YDR363W-A|YDR363W-A SEM1 SGDID:S000007235, Chr IV from 1202128-1202397, Genome Release 64-1-1, Verified ORF, "Component of the lid subcomplex of the regulatory subunit of the 26S proteasome; involved in mRNA export mediated by the TREX-2 complex (Sac3p-Thp1p); ortholog of human DSS1" ORGANISM: Saccharomyces cerevisiae S288C (89 aa)
MSTDVAAAQAQSKIDLTKKKNEEINKKSLEEDDEFEDFPIDTWANGETIKSNAVTQTNIW
EENWDDVEVDDDFTNELKAELDRYKRENQ