Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR357C  from Saccharomyces cerevisiae S288C
>YDR357C|YDR357C CNL1 SGDID:S000002765, Chr IV from 1189567-1189199, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Protein of unknown function; likely member of BLOC complex involved in endosomal cargo sorting; null mutant is sensitive to drug inducing secretion of vacuolar cargo; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm" ORGANISM: Saccharomyces cerevisiae S288C (122 aa)
MQDNSSHSRESASAGDDPLGIDKLTVDYDYLLYKMRDYVQSIQLDTTELCKKQNEVMVNG
IIENTIDKNIAKFKELLEKCDTLENHYEMLNQLAIITDTFKERIAEAVNNYNSLKKGASK
SK