Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR339C  from Saccharomyces cerevisiae S288C
>YDR339C|YDR339C FCF1 SGDID:S000002747, Chr IV from 1150520-1149951, Genome Release 64-1-1, reverse complement, Verified ORF, "Putative PINc domain nuclease required for early cleavages of 35S pre-rRNA and maturation of 18S rRNA; component of the SSU (small subunit) processome involved in 40S ribosomal subunit biogenesis; copurifies with Faf1p" ORGANISM: Saccharomyces cerevisiae S288C (189 aa)
MGKAKKTRKFGLVKRTLNTKKDQRLKKNQENIKTKEDPELTRNIPQVSSALFFQYNQAIK
PPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLGPKYRIALKLA
RDPRIKRLSCSHKGTYADDCLVHRVLQHKCYIVATNDAGLKQRIRKIPGIPLMSVGGHAY
VIEKLPDVF