Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR320C-A  from Saccharomyces cerevisiae S288C
>YDR320C-A|YDR320C-A DAD4 SGDID:S000007604, Chr IV from 1108498-1108280, Genome Release 64-1-1, reverse complement, Verified ORF, "Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by MT depolymerization thereby aiding in chromosome segregation; is transferred to the kinetochore prior to mitosis" ORGANISM: Saccharomyces cerevisiae S288C (72 aa)
MENPHEQVQANILSRIIGNVKRLNESVAILNQELVTINNRNKNLEIMGAICDNYHSSVQF
NLEATNNKKPPL