Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR308C  from Saccharomyces cerevisiae S288C
>YDR308C|YDR308C SRB7 SGDID:S000002716, Chr IV from 1078449-1078027, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of the RNA polymerase II mediator complex; associates with core polymerase subunits to form the RNA polymerase II holoenzyme; essential for transcriptional regulation; target of the global repressor Tup1p" ORGANISM: Saccharomyces cerevisiae S288C (140 aa)
MTDRLTQLQICLDQMTEQFCATLNYIDKNHGFERLTVNEPQMSDKHATVVPPEEFSNTID
ELSTDIILKTRQINKLIDSLPGVDVSAEEQLRKIDMLQKKLVEVEDEKIEAIKKKEKLLR
HVDSLIEDFVDGIANSKKST