Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR304C  from Saccharomyces cerevisiae S288C
>YDR304C|YDR304C CPR5 SGDID:S000002712, Chr IV from 1072557-1071880, Genome Release 64-1-1, reverse complement, Verified ORF, "Peptidyl-prolyl cis-trans isomerase (cyclophilin) of the endoplasmic reticulum, catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; transcriptionally induced in response to unfolded proteins in the ER" ORGANISM: Saccharomyces cerevisiae S288C (225 aa)
MKLQFFSFITLFACLFTTAIFAKEDTAEDPEITHKVYFDINHGDKQIGRIVMGLYGLTTP
QTVENFYQLTISRDPKMGYLNSIFHRVIPNFMIQGGDFTHRSGIGGKSIFGNTFKDENFD
VKHDKPGRLSMANRGKNTNGSQFFITTVPCPWLDGKHVVFGEVLDGMDVVHYIENVKTDS
RNMPVKEVIIVESGELETVPLDNKDAAKLQEEIKAEASEAAHDEL