Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR298C  from Saccharomyces cerevisiae S288C
>YDR298C|YDR298C ATP5 SGDID:S000002706, Chr IV from 1058814-1058176, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit 5 of the stator stalk of mitochondrial F1F0 ATP synthase, which is an evolutionarily conserved enzyme complex required for ATP synthesis; homologous to bovine subunit OSCP (oligomycin sensitivity-conferring protein); phosphorylated" ORGANISM: Saccharomyces cerevisiae S288C (212 aa)
MFNRVFTRSFASSLRAAASKAAAPPPVRLFGVEGTYATALYQAAAKNSSIDAAFQSLQKV
ESTVKKNPKLGHLLLNPALSLKDRNSVIDAIVETHKNLDGYVVNLLKVLSENNRLGCFEK
IASDFGVLNDAHNGLLKGTVTSAEPLDPKSFKRIEKALSASKLVGQGKSLKLENVVKPEI
KGGLIVELGDKTVDLSISTKIQKLNKVLEDSI