Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YDR281C  from Saccharomyces cerevisiae S288C
>YDR281C|YDR281C PHM6 SGDID:S000002689, Chr IV from 1022321-1022007, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function, expression is regulated by phosphate levels" ORGANISM: Saccharomyces cerevisiae S288C (104 aa)
MEDTSRCIDDVLKIGQQEKEIRQAEFSDAQGEREEVKCIDYTVDLEAGLPRHESSGKSNT
LKQCYNAVLGFLEELIIVIIIVLLLYSLTMVGLFYVMTMTKFLF