>YDR276C|YDR276C PMP3 SGDID:S000002684, Chr IV from 1013643-1013476, Genome Release 64-1-1, reverse complement, Verified ORF, "Small plasma membrane protein related to a family of plant polypeptides that are overexpressed under high salt concentration or low temperature, not essential for viability, deletion causes hyperpolarization of the plasma membrane potential" ORGANISM: Saccharomyces cerevisiae S288C (55 aa)
MDSAKIINIILSLFLPPVAVFLARGWGTDCIVDIILTILAWFPGMLYALYIVLQD