Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR260C  from Saccharomyces cerevisiae S288C
>YDR260C|YDR260C SWM1 SGDID:S000002668, Chr IV from 977229-976717, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of the anaphase-promoting complex, which is an E3 ubiquitin ligase that regulates the metaphase-anaphase transition and exit from mitosis; required for activation of the daughter-specific gene expression and spore wall maturation" ORGANISM: Saccharomyces cerevisiae S288C (170 aa)
MSSSSYRDSYFQYRHLPAPHHILYAEWNQDILALPDEVANITMAMKDNTRTDAEEGRAPQ
DGERNSNVRESAQGKALMTSEQNSNRYWNSFHDEDDWNLFNGMELESNGVVTFAGQAFDH
SLNGGTNSRNDGANEPRKETITGSIFDRRITQLAYARNNGWHELALPQSR