Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR252W  from Saccharomyces cerevisiae S288C
>YDR252W|YDR252W BTT1 SGDID:S000002660, Chr IV from 963412-963861, Genome Release 64-1-1, Verified ORF, "Beta3 subunit of the heterotrimeric nascent polypeptide-associated complex which binds ribosomes via its beta-subunits in close proximity to nascent polypeptides; interacts with Caf130p of the CCR4-NOT complex; similar to human BTF3" ORGANISM: Saccharomyces cerevisiae S288C (149 aa)
MPVDQEKLAKLHKLSAANKVGGTRRKINKKGNLYNNNDKDNTKLQAELHKLHPMTIENVA
EANFFKKNGKVLHFNSAVVQIAPQCNLTMIHGQPKENTLNGLYPSVASQLGSQELEYLTG
LAHNLENEQTVLDQLGDRCSETKQQVMNS