Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR248C  from Saccharomyces cerevisiae S288C
>YDR248C|YDR248C YDR248C SGDID:S000002656, Chr IV from 958339-957758, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; sequence similarity to bacterial and human gluconokinase; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm; upregulated by deletion of the RNAP-II associated factor, PAF1" ORGANISM: Saccharomyces cerevisiae S288C (193 aa)
MTEKHKTMGKFKVIVLAGTAGTGKSTIAGELIHEFKDIYPDLKFIEGDDLHPPANVEKMT
RGIPLNDDDRWDWLKKVAVESTKAAASTKEHLSIVACSSLKKKYRDLIRHTCPESEFHFI
FLYASKIEVLKRLKTRKGHFMKADMMESQFRDLELPDINDETDCDIVPLDFKTFYQIEKD
VIQVVKSKVLNIE