Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YDR246W-A  from Saccharomyces cerevisiae S288C
>YDR246W-A|YDR246W-A YDR246W-A SGDID:S000028542, Chr IV from 955133-955333, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by fungal homology and RT-PCR" ORGANISM: Saccharomyces cerevisiae S288C (66 aa)
MRRLYRHLASFFLLPSCPGNTIQSITSYPANALLRSFRHVSTETPVRNRVHNRDSQSCPF
FPLMDD