Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR224C  from Saccharomyces cerevisiae S288C
>YDR224C|YDR224C HTB1 SGDID:S000002632, Chr IV from 914712-914317, Genome Release 64-1-1, reverse complement, Verified ORF, "Histone H2B, core histone protein required for chromatin assembly and chromosome function; nearly identical to HTB2; Rad6p-Bre1p-Lge1p mediated ubiquitination regulates transcriptional activation, meiotic DSB formation and H3 methylation" ORGANISM: Saccharomyces cerevisiae S288C (131 aa)
MSAKAEKKPASKAPAEKKPAAKKTSTSTDGKKRSKARKETYSSYIYKVLKQTHPDTGISQ
KSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTR
AVTKYSSSTQA