Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR210W  from Saccharomyces cerevisiae S288C
>YDR210W|YDR210W YDR210W SGDID:S000002618, Chr IV from 871074-871301, Genome Release 64-1-1, Uncharacterized ORF, "Predicted tail-anchored plasma membrane protein containing a conserved CYSTM module; related proteins in other organisms may be involved in response to stress; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery" ORGANISM: Saccharomyces cerevisiae S288C (75 aa)
MSQQQGYYQQGPPQQGYYQQGPPQQGYYQQGPPQQGYPQQQPVYVQQGQPKEESCLDSCL
KCLCCCFLLELVCDN