Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR201W  from Saccharomyces cerevisiae S288C
>YDR201W|YDR201W SPC19 SGDID:S000002609, Chr IV from 856317-856814, Genome Release 64-1-1, Verified ORF, "Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by MT depolymerization thereby aiding in chromosome segregation; also localized to nuclear side of spindle pole body" ORGANISM: Saccharomyces cerevisiae S288C (165 aa)
MTDALEQSVLALEGTVSVLKDSVESLKCANEPSTNLASTMLQTKRVFRLVPEYDVERSKL
DLIEEVEPLVRTLGDKLRKSMGRMQRELDTLQQTYELNDLRLKKNISMDDDDALNSPDMG
QEYEGRDADDVVMMASSTNEELEELKKLKEKKKQLENKLEILKQK