Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YDR194W-A  from Saccharomyces cerevisiae S288C
>YDR194W-A|YDR194W-A YDR194W-A SGDID:S000028541, Chr IV from 848071-848223, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by fungal homology and RT-PCR" ORGANISM: Saccharomyces cerevisiae S288C (50 aa)
MKQMMIEASISKDTLRLLICFFEIKQCHISLQPTCYYQNWVRYSSIYYQL