Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR185C  from Saccharomyces cerevisiae S288C
>YDR185C|YDR185C UPS3 SGDID:S000002593, Chr IV from 832473-831934, Genome Release 64-1-1, reverse complement, Verified ORF, "Mitochondrial protein of unknown function; similar to Ups1p and Ups2p which are involved in regulation of mitochondrial cardiolipin and phosphatidylethanolamine levels; null is viable but interacts synthetically with ups1 and ups2 mutations" ORGANISM: Saccharomyces cerevisiae S288C (179 aa)
MKSFQKSYEFDYPWEKVTTANWMKYPNKISTHVIAVDVLRRELKEHGDVLLTERLITIRQ
NTPHWMSILVGNTNLAYVREVSTVDRRDRSLTMRSCNMTFPHILKCYETVRYVPHPKNPS
NVTLFKQDAKFLSGVPTKTFSEKVENWGVKRFSDNAVKGKVGFDSILAMFNDIWKNANE