Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR179C  from Saccharomyces cerevisiae S288C
>YDR179C|YDR179C CSN9 SGDID:S000002586, Chr IV from 819196-818708, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of the Cop9 signalosome, which is required for deneddylation, or removal of the ubiquitin-like protein Rub1p from Cdc53p (cullin); involved in adaptation to pheromone signaling" ORGANISM: Saccharomyces cerevisiae S288C (162 aa)
MVMREETIKSLEDPYKYHYKEEWLNTKDPDEQQLFEIFAFGNIKDLPENIILTSLMRSKL
EKLTLVTLSEIYNELSYELIKEECQIEDDGIIESHLIQLQNIFKAEMDSVSKSMKFSRRF
DCRDVYCHEKELTIIKNPRVTKEYLVQNLRSWETKLKQNILE