Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YDR169C-A  from Saccharomyces cerevisiae S288C
>YDR169C-A|YDR169C-A YDR169C-A SGDID:S000028538, Chr IV from 794723-794574, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by fungal homology and RT-PCR" ORGANISM: Saccharomyces cerevisiae S288C (49 aa)
MMRMSLKQMQSQRFSATSRVRMLLIGASGLRSSSSKLECPRFSNKHGRN