Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR163W  from Saccharomyces cerevisiae S288C
>YDR163W|YDR163W CWC15 SGDID:S000002570, Chr IV from 781423-781950, Genome Release 64-1-1, Verified ORF, "Non-essential protein involved in pre-mRNA splicing, component of a complex containing Cef1p; has similarity to S. pombe Cwf15p" ORGANISM: Saccharomyces cerevisiae S288C (175 aa)
MTTSHRPQLEARSGAKAAAYTPTGIEHARLLPGHTTLKYRKFKEEENLRANCAQEDRSND
KSLEEAVMNEEKQDVVGSGNLQETRSEKDQKDSLQELLVTQKNKVEDKAELEGNEQLKGG
NSSRRSWRKGTAFGRHKVTKETNIKEHATKKSASGYINDMTKSEYHQEFLHKHVR