Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR162C  from Saccharomyces cerevisiae S288C
>YDR162C|YDR162C NBP2 SGDID:S000002569, Chr IV from 781100-780390, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein involved in the HOG (high osmolarity glycerol) pathway, negatively regulates Hog1p by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p complex, found in the nucleus and cytoplasm, contains an SH3 domain that binds Pbs2p" ORGANISM: Saccharomyces cerevisiae S288C (236 aa)
MATMETTTQKDTNILKSGLKKTIGVLNEAVLQNGREVEAVQAGNSDTMEDTETTTIGYIS
IKDYAYADSNPLHYGYFDGDNEEDEMVSDSSNGEDTYNKRQSITLPDDYIVNQRAVALYD
FEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFVSYIQPEDGENEVEN
KARPFYLTHLITQSVSPKNNIDNTNEDEYDDNDEWEDIDDVAEVEADMKTKLDISD