Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR155C  from Saccharomyces cerevisiae S288C
>YDR155C|YDR155C CPR1 SGDID:S000002562, Chr IV from 769000-768512, Genome Release 64-1-1, reverse complement, Verified ORF, "Cytoplasmic peptidyl-prolyl cis-trans isomerase (cyclophilin), catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; binds the drug cyclosporin A" ORGANISM: Saccharomyces cerevisiae S288C (162 aa)
MSQVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFGYAGSPFHRVIPDFML
QGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWL
DGKHVVFGEVVDGYDIVKKVESLGSPSGATKARIVVAKSGEL