Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR139C  from Saccharomyces cerevisiae S288C
>YDR139C|YDR139C RUB1 SGDID:S000002546, Chr IV from 733702-733618,733924-733776, Genome Release 64-1-1, reverse complement, Verified ORF, "Ubiquitin-like protein with similarity to mammalian NEDD8; conjugation (neddylation) substrates include the cullins Cdc53p, Rtt101p, and Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair); conjugation mediated by Ubc12p (E2 enzyme)" ORGANISM: Saccharomyces cerevisiae S288C (77 aa)
MIVKVKTLTGKEISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAH
LVEGMQLHLVLTLRGGN