Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR119W-A  from Saccharomyces cerevisiae S288C
>YDR119W-A|YDR119W-A YDR119W-A SGDID:S000113555, Chr IV from 691014-691214, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; may interact with respiratory chain complexes III (ubiquinol-cytochrome c reductase) or IV (cytochrome c oxidase)" ORGANISM: Saccharomyces cerevisiae S288C (66 aa)
MFFSQVLRSSARAAPIKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFF
SKARKA