Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR115W  from Saccharomyces cerevisiae S288C
>YDR115W|YDR115W YDR115W SGDID:S000002522, Chr IV from 682175-682492, Genome Release 64-1-1, Uncharacterized ORF, "Putative mitochondrial ribosomal protein of the large subunit, has similarity to E. coli L34 ribosomal protein; required for respiratory growth, as are most mitochondrial ribosomal proteins" ORGANISM: Saccharomyces cerevisiae S288C (105 aa)
MPLFARLCQPQSRRMFSSISSFSALSVLRPQTGMLLNSSPLKTPSFTPLGFGLIGQRRWK
SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH