Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR100W  from Saccharomyces cerevisiae S288C
>YDR100W|YDR100W TVP15 SGDID:S000002507, Chr IV from 655013-655444, Genome Release 64-1-1, Verified ORF, "Integral membrane protein localized to late Golgi vesicles along with the v-SNARE Tlg2p" ORGANISM: Saccharomyces cerevisiae S288C (143 aa)
MSVIPPKFFKIANISIGCIDIIAALSQLTYIFTNLNVFLLAVYGLALSVPIVYLEFKVPS
NLYRYASFYFSFLGRGLSYILLSLIISFGGIYNILAGMFTFILGVAFIVFHFSQFVEEPA
NFRAPGSSLSIGDDDIDDDDDMI