Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR092W  from Saccharomyces cerevisiae S288C
>YDR092W|YDR092W UBC13 SGDID:S000002499, Chr IV from 629876-629905,630174-630605, Genome Release 64-1-1, Verified ORF, "Ubiquitin-conjugating enzyme involved in the error-free DNA postreplication repair pathway; interacts with Mms2p to assemble ubiquitin chains at the Ub Lys-63 residue; DNA damage triggers redistribution from the cytoplasm to the nucleus" ORGANISM: Saccharomyces cerevisiae S288C (153 aa)
MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPD
DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP
LANDVAEDWIKNEQGAKAKAREWTKLYAKKKPE