Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR086C  from Saccharomyces cerevisiae S288C
>YDR086C|YDR086C SSS1 SGDID:S000002493, Chr IV from 617170-616928, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit of the Sec61p translocation complex (Sec61p-Sss1p-Sbh1p) that forms a channel for passage of secretory proteins through the endoplasmic reticulum membrane, and of the Ssh1p complex (Ssh1p-Sbh2p-Sss1p); interacts with Ost4p and Wbp1p" ORGANISM: Saccharomyces cerevisiae S288C (80 aa)
MARASEKGEEKKQSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKIVKAVGIGFIA
VGIIGYAIKLIHIPIRYVIV