Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR079W  from Saccharomyces cerevisiae S288C
>YDR079W|YDR079W PET100 SGDID:S000002486, Chr IV from 603064-603399, Genome Release 64-1-1, Verified ORF, "Chaperone that specifically facilitates the assembly of cytochrome c oxidase, integral to the mitochondrial inner membrane; interacts with a subcomplex of subunits VII, VIIa, and VIII (Cox7p, Cox9p, and Cox8p) but not with the holoenzyme" ORGANISM: Saccharomyces cerevisiae S288C (111 aa)
MGLFNNFKFKYTRAQLEIFRFSFCLLAPVAVMYYIGTDTDKKLNVPGFWPDPATLNQIPK
EPYEIKAELARMKKERLEKRLRLEKKIQEEFGLDLEEEKEKIKRDLALKKG