Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR079C-A  from Saccharomyces cerevisiae S288C
>YDR079C-A|YDR079C-A TFB5 SGDID:S000007603, Chr IV from 603811-603593, Genome Release 64-1-1, reverse complement, Verified ORF, "Component of the RNA polymerase II general transcription and DNA repair factor TFIIH; involved in transcription initiation and in nucleotide-excision repair; homolog of Chlamydomonas reinhardtii REX1-S protein involved in DNA repair" ORGANISM: Saccharomyces cerevisiae S288C (72 aa)
MARARKGALVQCDPSIKALILQIDAKMSDIVLEELDDTHLLVNPSKVEFVKHELNRLLSK
NIYNPMDEEENQ