Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR073W  from Saccharomyces cerevisiae S288C
>YDR073W|YDR073W SNF11 SGDID:S000002480, Chr IV from 592439-592948, Genome Release 64-1-1, Verified ORF, "Subunit of the SWI/SNF chromatin remodeling complex involved in transcriptional regulation; interacts with a highly conserved 40-residue sequence of Snf2p" ORGANISM: Saccharomyces cerevisiae S288C (169 aa)
MSSEIAYSNTNTNTENENRNTGAGVDVNTNANANANATANATANATANATAELNLPTVDE
QRQYKVQLLLHINSILLARVIQMNNSLQNNLQNNINNSNNNNIIRIQQLISQFLKRVHAN
LQCISQINQGVPSAKPLILTPPQLANQQQPPQDILSKLYLLLARVFEIW