Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR070C  from Saccharomyces cerevisiae S288C
>YDR070C|YDR070C FMP16 SGDID:S000002477, Chr IV from 588379-588098, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; proposed to be involved in responding to conditions of stress; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies" ORGANISM: Saccharomyces cerevisiae S288C (93 aa)
MLRTTFLRTPRQLMRKSPRASFSIVTRAAFPHLKNNQDEAEKKEQGLFDSNKKRLDTLEH
GKNPDYKQPGMEDLKKKGDDARIEQNRPDDGVY