Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR067C  from Saccharomyces cerevisiae S288C
>YDR067C|YDR067C OCA6 SGDID:S000002474, Chr IV from 583465-582791, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Cytoplasmic protein required for replication of Brome mosaic virus in S. cerevisiae, which is a model system for studying positive-strand RNA virus replication; null mutation confers sensitivity to tunicamycin and DTT" ORGANISM: Saccharomyces cerevisiae S288C (224 aa)
MTLVTPLQFSTVQPNLYRGSYPREINLPFLRTLRLKYILSLTPEPLSTDPLMVKFCEENN
IKTIHIKCQSERKADKTKPKIKRKKKTVPIEYDVVVRCVKFLIDKGHYPCYMHCTNGELI
ISLVVACMRKFSYWSTVSILNEFLVYNSSINIHERNFIENFNSEIEVDDLDIKDKVPWIT
VRYIARTATESKDELRVDDANASEKVARVSSVSNSLPKLKFHSM