Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR066C  from Saccharomyces cerevisiae S288C
>YDR066C|YDR066C RTR2 SGDID:S000002473, Chr IV from 582498-581908, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Protein of unknown function with high similarity to Rtr1p; exhibits genetic interactions with Rtr1p; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm; YDR066C is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (196 aa)
MQIITTTFIQKVILGSHQLHEQLSIVEARMIESAIVSMLTESFCENEQTLKYLARLLSPM
SYMDVINARRGKKICGYPLCYKSAAENSSDGFFIHSMYCNNYHSKCSLYLMRQLSQTPLH
ERRGVHLTSYINLEFDDMYSVSLLEELVGSEVPIDTVKSLITSFKDLEFDDTYKNEPLPL
DVYFGQLTTDEETCIE