Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR063W  from Saccharomyces cerevisiae S288C
>YDR063W|YDR063W AIM7 SGDID:S000002470, Chr IV from 578663-579112, Genome Release 64-1-1, Verified ORF, "Protein that interacts with Arp2/3 complex to stimulate actin filament debranching and inhibit actin nucleation; has similarity to Cof1p and also to human glia maturation factor (GMF); null mutant displays elevated mitochondrial genome loss" ORGANISM: Saccharomyces cerevisiae S288C (149 aa)
MSNLYKIGTETRNKIKKFRTSTARTDSIKALSIKIEPKPSYEIIVDEDEQEELDEIEDLS
ELAEILPDNSPRFVLTAYPTTTKDGFKQTPLVLVYWKPMTVVSQEWKMLYAGALEMIREE
CGTFKLIEVSSGLEDDSDVEELREQLENC