Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR059C  from Saccharomyces cerevisiae S288C
>YDR059C|YDR059C UBC5 SGDID:S000002466, Chr IV from 569633-569234,569770-569724, Genome Release 64-1-1, reverse complement, Verified ORF, "Ubiquitin-conjugating enzyme that mediates selective degradation of short-lived, abnormal, or excess proteins, including histone H3; central component of the cellular stress response; expression is heat inducible" ORGANISM: Saccharomyces cerevisiae S288C (148 aa)
MSSSKRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTD
YPFKPPKVNFTTKIYHPNINSSGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPL
VPEIAQIYKTDKAKYEATAKEWTKKYAV