Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR045C  from Saccharomyces cerevisiae S288C
>YDR045C|YDR045C RPC11 SGDID:S000002452, Chr IV from 548310-547978, Genome Release 64-1-1, reverse complement, Verified ORF, "RNA polymerase III subunit C11; mediates pol III RNA cleavage activity and is important for termination of transcription; homologous to TFIIS" ORGANISM: Saccharomyces cerevisiae S288C (110 aa)
MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGGGWD
NVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKEN