Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR034W-B  from Saccharomyces cerevisiae S288C
>YDR034W-B|YDR034W-B YDR034W-B SGDID:S000007234, Chr IV from 521314-521469, Genome Release 64-1-1, Uncharacterized ORF, "Predicted tail-anchored plasma membrane protein containing a conserved CYSTM module; related proteins in other organisms may be involved in response to stress; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery" ORGANISM: Saccharomyces cerevisiae S288C (51 aa)
MRHHQNMHYAPQQQPVYVQQPPPRRESGGCCRTCCHFLCCLCLINLCCDVF